PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009759591.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 332aa    MW: 36467.1 Da    PI: 9.5159
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009759591.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.54.7e-16262307551
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                     +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk + +e
  XP_009759591.1 262 RRQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENERLK-RQKE 307
                     79**************************************99.4444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000412.0E-6149164IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1701.0E-15252305No hitNo description
PRINTSPR000412.0E-6257273IPR001630cAMP response element binding (CREB) protein
SMARTSM003383.5E-13258326IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634260305IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-10262307No hitNo description
PfamPF001708.0E-13262305IPR004827Basic-leucine zipper domain
CDDcd147071.59E-23262307No hitNo description
PROSITE patternPS000360265280IPR004827Basic-leucine zipper domain
PRINTSPR000412.0E-6275295IPR001630cAMP response element binding (CREB) protein
PRINTSPR000412.0E-6295312IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGSQGGGGGG NSMGATQAQD PKPNALARQG SLYSLTLDEV QNQLGDLGKP LSSMNLDELL  60
KTVWTVEASQ GMGGTDYGVL QHSQVASGSS LHRQSSITLT GDLCKKTVDQ VWQDIQQGQK  120
RDNSDRKIQE RQRTLGEMTL EDFLVKAGVV AEPTPGKRSS SGSGLGGDSM ALPQQQAQWS  180
HYAMPQIPPQ QPQQQNMLPV FMPGHSVQQP LAVVANPIMD AAYPESQMTM SPTALLGTLS  240
DTQTLGRKRV APEDVVEKTV ERRQKRMIKN RESAARSRAR KQAYTHELEN KVSRLEEENE  300
RLKRQKEIEK VLPSVPPPEP KYQLRRTSSA PF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7368490.0KF736849.1 Nicotiana tabacum ABRE binding factor (ABF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009759591.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES33e-97AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV9XSB70.0V9XSB7_TOBAC; ABRE binding factor
STRINGPGSC0003DMT4000722600.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33342448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-97ABA-responsive element binding protein 3